PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0549s0150.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 679aa    MW: 76426.1 Da    PI: 6.0746
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0549s0150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68e-5651321128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             lppGfrFhPtdeelv +yL++k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWka
  SapurV1A.0549s0150.1.p   5 LPPGFRFHPTDEELVAYYLRRKINGHKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKA 90 
                             79****************************.99***************6434555777***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd++vls + ++vg+kktLv+y+grap+g +t Wvmheyrl
  SapurV1A.0549s0150.1.p  91 TGKDRKVLS-QMRAVGMKKTLVYYRGRAPHGARTGWVMHEYRL 132
                             *********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-643155IPR003441NAC domain
PROSITE profilePS5100561.2415155IPR003441NAC domain
PfamPF023658.5E-306132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MAPVLPPGFR FHPTDEELVA YYLRRKINGH KIELEIIPEV DLYKCEPWDL PGKSLLPSKD  60
LEWYFFSPRD RKYPNGSRTN RATKAGYWKA TGKDRKVLSQ MRAVGMKKTL VYYRGRAPHG  120
ARTGWVMHEY RLDERECETN TGLQDSYALC RVSKKNTNIP KIEEHYVSTA YRMPCEHSSS  180
IELYSDHGRS EEFESSNYPM HKNVDTCSTS YRGTVGSPLD ISESRNGKWA PAMDGFGMSA  240
PQFPSHSTIP YPSSNVNKAL ECARLQHRFT LPPLEVEDFP QVGLADIKMM QQPSMPESTS  300
THHTDILQET RSVAHAPQEL INQSSFQDTW GGNYAAPDLD FTFMSGKNVQ HNILSDMMMN  360
STRLADRSWI DPSTSSRYIE ISDLDEAFKT ERMVENLRWV GMSNDDLEKS FMEETKIVPI  420
ENISSFRSRG LHEVHGENGH ADDCMGFNDS DDFSLGFIND EPNDDTFIDE SNVDDLASSP  480
SFEVVEEIKV NHGLFVSTRQ ATETFFHQLV PSQTVKIYLN PAMVASNFSI EKADSTQSYG  540
TETTNSSTAR ENFTGSKSPV QYPWRNLARN VVCLIVIILM HRFYLGENVE NGKLMDGLIM  600
GSGCAGEEGC CPSKNIKPAM KPAGKLIKWG DSKKEKDFLV TIRGSGGTKF GVFLKNLGLF  660
LTISFALCTI LINHAMTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-54516117171NAC domain-containing protein 19
4dul_A2e-54516117171NAC domain-containing protein 19
1ut7_B2e-54516117171NO APICAL MERISTEM PROTEIN
1ut7_A2e-54516117171NO APICAL MERISTEM PROTEIN
1ut4_B2e-54516117171NO APICAL MERISTEM PROTEIN
1ut4_A2e-54516117171NO APICAL MERISTEM PROTEIN
3swp_D3e-54516120174NAC domain-containing protein 19
3swp_C3e-54516120174NAC domain-containing protein 19
3swp_B3e-54516120174NAC domain-containing protein 19
3swp_A3e-54516120174NAC domain-containing protein 19
3swm_D3e-54516120174NAC domain-containing protein 19
3swm_C3e-54516120174NAC domain-containing protein 19
3swm_B3e-54516120174NAC domain-containing protein 19
3swm_A3e-54516120174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038331.10.0PREDICTED: NAC domain-containing protein 86
RefseqXP_011038332.10.0PREDICTED: NAC domain-containing protein 86
TrEMBLU5FK200.0U5FK20_POPTR; Uncharacterized protein
STRINGPOPTR_0017s02020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-149NAC domain containing protein 28